PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G16000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 461aa    MW: 46709.6 Da    PI: 7.5223
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G16000.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32262315255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OGLUM08G16000.1 262 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 315
                      9****************************************************7 PP

2Myb_DNA-binding46.77.2e-15263314148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT  ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+y+
  OGLUM08G16000.1 263 RMRWTSSLHARFVHAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQMYR 314
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    
MASATSTTPD LSLHISLPSG GAAVGTTAPP GLGNGAAVGG AGGGKAAGGG DPWRRLDGST  60
ASTELSLSTP QQQQEGSTSA ADVLPWRLRQ PTAAAASVPV TLPTIPMDGS AAAARAPIRG  120
VPVYSGGGGG GHPFLGGGGG DHRHNRLYNP YHSTAWPSSS LCSTSPAPAP PPPPAALDPT  180
TSSLLSPSAY HRMLSSTGRL HGVLADTLRG YAGAAAVAGS IGYGSAAAAM GGYGGAGAGG  240
GFASSRFMPR LLPASRRSMR APRMRWTSSL HARFVHAVEL LGGHERATPK SVLELMDVKD  300
LTLAHVKSHL QMYRTVKSTD KPAAASGPMD GSGSGSGSGD DELLAGDGRQ ATSSGADADR  360
RMSFTEHRSS SEGAASHAGG GGDGDCSSSA VNSDTIRARS NSPRDLWLSS SVCNMDPQYL  420
VTVEDMEPCR SSSLQVSSHE LSSPSLEFTL GRPSWHSIDH D
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14250GGGKAAGGG
24351GGGKAAGGG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-30G2-like family protein