PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G12610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 307aa    MW: 33330 Da    PI: 6.514
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G12610.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-334599155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OGLUM08G12610.1 45 RQRLRWTNELHDRFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 99
                     58****************************************************8 PP

2Myb_DNA-binding61.12.4e-194798148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT e+++++v+av+qlGg+   t+k + r mg  g+t +++ks++qky+
  OGLUM08G12610.1 47 RLRWTNELHDRFVEAVTQLGGPdraTPKGVLRIMGvPGLTIYHVKSHLQKYR 98
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    
MYQPNPISSS GQTHGNPTAH EQMELGNNAI VPSNGGNNNP NMAARQRLRW TNELHDRFVE  60
AVTQLGGPDR ATPKGVLRIM GVPGLTIYHV KSHLQKYRLA KYIPDPSADD NKDEDKDPGN  120
LLSALEGSSG MQISEALKLQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQK IIEEQQRVIG  180
AGASRATSSE QLPDSVKTNP PTPVPISESP VQGASRSKNS QGQVEPTKSP SHDDALSCGE  240
PLTPDSSCRP GSPTLSPKHE RAAKRQRGSD AGDVTAFADG EFALPHGIFE SSTGSEFQEC  300
SMPYSGH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-78G2-like family protein