PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G12590.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 246aa    MW: 26888.5 Da    PI: 8.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G12590.4genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-333488155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av+qLGG++kAtPkti+++m+vkgLtl h+kSHLQkYRl
  OGLUM08G12590.4 34 KPRLRWTADLHDRFVDAVAQLGGPDKATPKTIMRTMGVKGLTLFHLKSHLQKYRL 88
                     79****************************************************8 PP

2Myb_DNA-binding69.84.5e-223687148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT+++++++vdav+qlGg+   t+ktI+rtmg kg+tl ++ks++qky+
  OGLUM08G12590.4 36 RLRWTADLHDRFVDAVAQLGGPdkaTPKTIMRTMGvKGLTLFHLKSHLQKYR 87
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    
MFPGLIHHHR LLDADVGGGG GGSSAGLVLT ADPKPRLRWT ADLHDRFVDA VAQLGGPDKA  60
TPKTIMRTMG VKGLTLFHLK SHLQKYRLGK QSGKEMAEQS KDASYILGAQ SGTNLSPTVP  120
TPDLKESQEL KEALRAQMEV QRKLHEQVEV QRHVQIRMEA YQNYIDTLLE KACNIVSEQL  180
NGFSISDHDL TSAGVMLSSS DTLSPSIFHQ LSVSSISLHS PGGKSSPFAA DADLFFQKAP  240
EKRKSY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.16e-67G2-like family protein