PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G12590.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 385aa    MW: 42032.8 Da    PI: 10.2225
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G12590.3genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.9e-101952262248
                      T....-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  22 g....tWktIartmg.kgRtlkqcksrwqkyl 48 
                      +    t+ktI+rtmg kg+tl ++ks++qky+
  OGLUM08G12590.3 195 RknesTPKTIMRTMGvKGLTLFHLKSHLQKYR 226
                      366779*************************7 PP

2G2-like47.44.2e-151972272555
          G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      ++ tPkti+++m+vkgLtl h+kSHLQkYRl
  OGLUM08G12590.3 197 NESTPKTIMRTMGVKGLTLFHLKSHLQKYRL 227
                      578***************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    
MQDAPCSGST GVAARGRSMS DKLLRSSAEE VCAPAEMAEQ GSSSAWGGSH SKQVVFAAES  60
AAEQALAAPR ALDAFTRPFR RAAVSAGWRF TIVGTRKYAF PRDLTRTSSL VMMCVILVAG  120
RNRATCSSCS FGTVRMTSSP RFTSDRSSRC RSRPPPEPAV RTPAAAAAPR LLRCFKDARR  180
ACFLAVSKKN EQGERKNEST PKTIMRTMGV KGLTLFHLKS HLQKYRLGKQ SGKEMAEQSK  240
DASYILGAQS GTNLSPTVPT PDLKESQELK EALRAQMEVQ RKLHEQVEVQ RHVQIRMEAY  300
QNYIDTLLEK ACNIVSEQLN GFSISDHDLT SAGVMLSSSD TLSPSIFHQL SVSSISLHSP  360
GGKSSPFAAD ADLFFQKAPE KRKSY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.13e-41G2-like family protein