PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G12590.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 431aa    MW: 46952.4 Da    PI: 10.2033
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G12590.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like40.94.6e-133461128
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAt 28
                     kprlrWt +LH+rFv+av+qLGG++ A 
  OGLUM08G12590.2 34 KPRLRWTADLHDRFVDAVAQLGGPDTAR 61
                     79***********************996 PP

2Myb_DNA-binding27.28.8e-093657122
                     TSSS-HHHHHHHHHHHHHTTTT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg 22
                     r+rWT+++++++vdav+qlGg+
  OGLUM08G12590.2 36 RLRWTADLHDRFVDAVAQLGGP 57
                     89******************98 PP

3Myb_DNA-binding31.44.5e-102412722248
                      T....-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  22 g....tWktIartmg.kgRtlkqcksrwqkyl 48 
                      +    t+ktI+rtmg kg+tl ++ks++qky+
  OGLUM08G12590.2 241 RknesTPKTIMRTMGvKGLTLFHLKSHLQKYR 272
                      366779*************************7 PP

4G2-like47.24.8e-152432732555
          G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      ++ tPkti+++m+vkgLtl h+kSHLQkYRl
  OGLUM08G12590.2 243 NESTPKTIMRTMGVKGLTLFHLKSHLQKYRL 273
                      578***************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    
MFPGLIHHHR LLDADVGGGG GGSSAGLVLT ADPKPRLRWT ADLHDRFVDA VAQLGGPDTA  60
RGRSMSDKLL RSSAEEVCAP AEMAEQGSSS AWGGSHSKQV VFAAESAAEQ ALAAPRALDA  120
FTRPFRRAAV SAGWRFTIVG TRKYAFPRDL TRTSSLVMMC VILVAGRNRA TCSSCSFGTV  180
RMTSSPRFTS DRSSRCRSRP PPEPAVRTPA AAAAPRLLRC FKDARRACFL AVSKKNEQGE  240
RKNESTPKTI MRTMGVKGLT LFHLKSHLQK YRLGKQSGKE MAEQSKDASY ILGAQSGTNL  300
SPTVPTPDLK ESQELKEALR AQMEVQRKLH EQVEVQRHVQ IRMEAYQNYI DTLLEKACNI  360
VSEQLNGFSI SDHDLTSAGV MLSSSDTLSP SIFHQLSVSS ISLHSPGGKS SPFAADADLF  420
FQKAPEKRKS Y
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.17e-41G2-like family protein