PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G12590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 451aa    MW: 49275 Da    PI: 10.2182
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G12590.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.34.8e-102612922248
                      T....-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  22 g....tWktIartmg.kgRtlkqcksrwqkyl 48 
                      +    t+ktI+rtmg kg+tl ++ks++qky+
  OGLUM08G12590.1 261 RknesTPKTIMRTMGvKGLTLFHLKSHLQKYR 292
                      366779*************************7 PP

2G2-like47.15.1e-152632932555
          G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      ++ tPkti+++m+vkgLtl h+kSHLQkYRl
  OGLUM08G12590.1 263 NESTPKTIMRTMGVKGLTLFHLKSHLQKYRL 293
                      578***************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    
MDGGEGGVLR EGGEVGGEGW KRKSSLGHVA WSNLPTQRVS LDRCLGEKEL GVASPSEASR  60
GLAKERLFCF FERKQTASAA RGRSMSDKLL RSSAEEVCAP AEMAEQGSSS AWGGSHSKQV  120
VFAAESAAEQ ALAAPRALDA FTRPFRRAAV SAGWRFTIVG TRKYAFPRDL TRTSSLVMMC  180
VILVAGRNRA TCSSCSFGTV RMTSSPRFTS DRSSRCRSRP PPEPAVRTPA AAAAPRLLRC  240
FKDARRACFL AVSKKNEQGE RKNESTPKTI MRTMGVKGLT LFHLKSHLQK YRLGKQSGKE  300
MAEQSKDASY ILGAQSGTNL SPTVPTPDLK ESQELKEALR AQMEVQRKLH EQVEVQRHVQ  360
IRMEAYQNYI DTLLEKACNI VSEQLNGFSI SDHDLTSAGV MLSSSDTLSP SIFHQLSVSS  420
ISLHSPGGKS SPFAADADLF FQKAPEKRKS Y
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-40G2-like family protein