PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G03750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 167aa    MW: 18216.2 Da    PI: 5.8134
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G03750.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.3e-31152455
          G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OGLUM08G03750.1  1 MRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
                     79*************************************************7 PP

2Myb_DNA-binding46.77.4e-15151248
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     +rWT  ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+y+
  OGLUM08G03750.1  1 MRWTSTLHARFVHAVELLGGHdraTPKSVLELMDvKDLTLAHVKSHLQMYR 51
                     59***********************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    
MRWTSTLHAR FVHAVELLGG HDRATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKNTERPA  60
ASSDQADGFE NGSAGEICDE NSLDLHGGCR PEAMSAAATA AAAARHGRED WSGFHESNTG  120
TMQTLKDMQS KSLEILSDMN SCVSETTSST SELNLEFTLG RPQNRPN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-40G2-like family protein