PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G11980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 417aa    MW: 45318.1 Da    PI: 5.0539
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G11980.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.4e-32246300155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
  OGLUM07G11980.1 246 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 300
                      68****************************************************8 PP

2Myb_DNA-binding56.28e-18248299148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e++e++vdav++lGg    t+k + + m   ++t +++ks++qky+
  OGLUM07G11980.1 248 RMRWTPELHERFVDAVNLLGGSekaTPKGVLKLMKaDNLTIYHVKSHLQKYR 299
                      89******************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    
MERISTNQLY NSGIPVTVPS PLPAIPATLD ENIPRIPDGQ NVPRERELRS TPMPPHQNQS  60
TVAPLHGHFQ SSTGSVGPLR SSQAIRFSSV SSNEQYTNAN LYNSQPPSSG SSSTLNYGSQ  120
YGGFEPSLTD FPRDAGPTWC PDPVDGLLGY TDDVPAGNNL TENSSIAAGD ELAKQSEWWN  180
DFMNYDWKDI DNTACTETQP QVGPAAQSSV AVHQSAAQQS VSSQSGEPSA VAIPSPSGAS  240
NTSNSKTRMR WTPELHERFV DAVNLLGGSE KATPKGVLKL MKADNLTIYH VKSHLQKYRT  300
ARYRPELSEG SSEKKAASKE DIPSIDLKGG NFDLTEALRL QLELQKRLHE QLEIQRSLQL  360
RIEEQGKCLQ MMLEQQCIPG TDKAVDASTS AEGTKPSSDL PESSAVKDVP ENKSGNR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-63G2-like family protein