PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G01230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 357aa    MW: 38312.2 Da    PI: 6.9224
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G01230.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-32230285156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+p+LH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OGLUM07G01230.1 230 KTRRCWSPDLHRKFVAALQQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 285
                      68****************************************************97 PP

2Myb_DNA-binding44.24.6e-14232283148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W+++++ ++v a +qlGg+   t+k I + m   g+t  ++ks++qky+
  OGLUM07G01230.1 232 RRCWSPDLHRKFVAALQQLGGPqvaTPKQIRELMKvDGLTNDEVKSHLQKYR 283
                      568************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    
MGLDVGEIGV GAADLSLDLK MFAAKSFGRV RGKDTTTTAM GDCIRRLEEE MGKIEVFRRE  60
LPLCVRLLAD VIDVMKEEVE KKGGDRKEDE EDAAGDKSNW MSTAQLWTGN SGGPDAAAAD  120
PEKQDKVRIS SEAKSNGGAF VGSGAPAFAR PKQSLMRKED MAYDVRMPDL SLLSPPASAA  180
AADESRRQVV GFAQAAARAA AMAASGPALS LQPQPQPAAA QQQQQQQARK TRRCWSPDLH  240
RKFVAALQQL GGPQVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHNRPRV PSSTIVNQPI  300
VLMQGLCYIP QEQSSSQSGS PEGPLHFSGS GMAGGGSSAA TVSCEEEDGR SESYGWK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-31G2-like family protein