PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G25550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 256aa    MW: 28576.7 Da    PI: 6.789
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G25550.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.31.1e-301871255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     pr+rWt+eLH++Fveave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  OGLUM06G25550.1 18 PRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRS 71
                     8****************************************************7 PP

2Myb_DNA-binding48.61.9e-151970148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT+e++ ++v+av+ lGg    t+k+I + mg kg +  ++ks++q+y+
  OGLUM06G25550.1 19 RMRWTEELHRQFVEAVECLGGQdeaTPKRILQLMGvKGVSISHIKSHLQMYR 70
                     89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    
MGGFERRGVR QYNRSEVPRM RWTEELHRQF VEAVECLGGQ DEATPKRILQ LMGVKGVSIS  60
HIKSHLQMYR SGSSNSNHPV SLQKLTSATV NNISKREFVN SEDRCIYASE DRNTASSDKN  120
THTILRCGRS SMPSIEEIFR NWEQTRGRLL PWNSNVITTE QATRASRQTT NYSKPLKQLT  180
DCDLTLSIGQ LWEDAAGSDA DGSSTISEEV AAPSRDEAFV SSADDHFAAA AAKKKESNML  240
TTDLNLDLTI SSSWLS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-28G2-like family protein