PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G25170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 337aa    MW: 36652.4 Da    PI: 8.2816
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G25170.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.8e-3355109155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  OGLUM06G25170.1  55 KPRLRWTVELHDRFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 109
                      79****************************************************8 PP

2Myb_DNA-binding70.92e-2257108148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT e+++++vdav+qlGg+   t+ktI+r mg kg+tl+++ks++qk++
  OGLUM06G25170.1  57 RLRWTVELHDRFVDAVTQLGGPdkaTPKTIMRVMGvKGLTLYHLKSHLQKFR 108
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    
MFPSSSPSPS SSSKKQQQLS GGVGVGGAAA AASSNDRPPL CVQGDSGLVL TTDPKPRLRW  60
TVELHDRFVD AVTQLGGPDK ATPKTIMRVM GVKGLTLYHL KSHLQKFRLG KQHKDFNDHS  120
VKDAMDMQRN AASSSGIMGR SMNDRSVHVN EALRMKMEVQ RRFHEQLEVQ KHLQMRVEAQ  180
GKYMQTILEK AYQAISSSGD CATWHAGYKS LGSQAVLDIG SSMSFPSLQD DLQLYGGSHL  240
DHLHQQHEQM EIRPSIDTFL AFNYSSSTGK SPMVWPGADD GGGEPAKISG DHQLQMAAPA  300
TTTMMMEAIT MSGGDSMGSK GFEGQMSSKL DMRSPPP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-83G2-like family protein