PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G21780.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 319aa    MW: 34770.5 Da    PI: 5.4256
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G21780.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-3347101155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      ++rlrWt +LH+rFv+av+qLGG+++AtPk il++m+v+gLt++hvkSHLQkYRl
  OGLUM06G21780.2  47 RQRLRWTDDLHDRFVDAVTQLGGPDRATPKGILRIMGVQGLTIYHVKSHLQKYRL 101
                      58****************************************************8 PP

2Myb_DNA-binding62.49.5e-2049100148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT ++++++vdav+qlGg+   t+k I r mg +g+t +++ks++qky+
  OGLUM06G21780.2  49 RLRWTDDLHDRFVDAVTQLGGPdraTPKGILRIMGvQGLTIYHVKSHLQKYR 100
                      89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    
MYEPKPFSSI VLAHNDPVSH NQQIERINNN VVSNSGGNSS NSNFAARQRL RWTDDLHDRF  60
VDAVTQLGGP DRATPKGILR IMGVQGLTIY HVKSHLQKYR LAKYIPDPTA DGAKSDKKDL  120
GDLLADIESS SGMEIGEALK LQMEVQRQLQ LRIEAQGRYL QKIIEEQQRL SGVLGESGKL  180
GALGPAPGEP YQDSNKTDPS TPVPTSESPI RDKAGSGLFK TISSHDDCRE PLTPDSSCRA  240
GSPLESPPRA SKRIRVSSDI DHRGNNEFPP PLKVPEPSSG SDFRQESSVL LSSSTVHFDS  300
LESLDADENV FTNGSGSDD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-88G2-like family protein