PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G18870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 528aa    MW: 56875.7 Da    PI: 6.615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G18870.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31125178255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  OGLUM06G18870.1 125 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 178
                      8****************************************************7 PP

2Myb_DNA-binding47.93e-15126177148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT++++  +v+av++lGg    t+k++ ++m+  g++  ++ks++q+y+
  OGLUM06G18870.1 126 RLRWTPDLHMAFVHAVERLGGQeraTPKLVLQMMNvRGLSIAHVKSHLQMYR 177
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    
MGEVKEKEVV EIFEHDHDNK IRSPENSVPP AMVLDLNEGF GEGSEEGGVG EDGDEEDDDE  60
DDDDDDDGGS TSEVAGGGRS SSNNSSTNHN SGSDKDHDMN SSSSKADGGG DRVPTVRQYN  120
RSKLPRLRWT PDLHMAFVHA VERLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK  180
LDHESGHERG AISSVFSPME FHMRRGDHRF HHHDMFFQRA AAAGVSPFSS RMLHENGGGF  240
FASRNPGLPE SSRLYGLFQR RQQAPMQTFD FKNCNNFSRN QEWAFNQQHA AARAAGAVNG  300
HGPAKGLIHE MIFRKEGKPT SHLFDVRDAI ASTRVTSATT AAAADHRLDG AGKAGNFDWI  360
GSSSSRPLTR TMSAAAAATM GDHHHLRWRG GAACSGAALG SLLERAKTKA TEAMRLETPV  420
KMTAAAVAAE EINGRTPDLQ LSLSPNAGDH RSAGKKRKFL SEQEVDSDKQ QLPLTLSLSL  480
RGGGDNGGGG GGEAAGRLEE EMTGSSSSKK AALGLSTLDL TMSIKALE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-34G2-like family protein