PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G15080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 455aa    MW: 48573.7 Da    PI: 4.7349
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G15080.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27180234156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  OGLUM06G15080.1 180 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 234
                      6799*****************.********************************86 PP

2Myb_DNA-binding40.56.5e-13183232248
                      SSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                        WT+e++ ++v+av+qlG +   +++I + mg   +t+ ++ s++qky+
  OGLUM06G15080.1 183 VDWTPELHRRFVQAVEQLGIDkaVPSRILEIMGiDSLTRHNIASHLQKYR 232
                      57***********************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    
MLAVSPAMCP DIEDRAAVAG DAGMEVVGMS SDDMDQFDFS VDDIDFGDFF LRLEDGDVLP  60
DLEVDPAEIF TDFEAIATSG GEGVQDQEVP TVELLAPADD VGVLDPCGDV VVGEENAAFA  120
GAGEEKGGCN QDDDAGEANA DDRAAAVEAK SSSPSSTTSS SQEAESRHKS SSKSSHGKKK  180
AKVDWTPELH RRFVQAVEQL GIDKAVPSRI LEIMGIDSLT RHNIASHLQK YRSHRKHMIA  240
REAEAASWTQ RRQIYAAGGG AVAKRPESNA WAVPTIGFPP PPPPPPSPAP MQHFARPLHV  300
WGHPTMDPSR VPVWPPRHLV PRGPAPPWVP PPPPSDPAFW HHPYMRGPAH VPTQGTPCMA  360
MPMPAARFPA PPVPGVVPCP MYRPLTPPAL ASKNQQDAQL QLQVQPSSES IDAAIGDVLS  420
KPWLPLPLGL KPPSVDSVMG ELQRQGVANV PPACG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-48G2-like family protein