PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G00620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 260aa    MW: 28443.1 Da    PI: 11.0519
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G00620.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.6e-29179229252
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ 
  OGLUM06G00620.1 179 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQN 229
                      9*************************************************7 PP

2Myb_DNA-binding48.52e-15180231148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWTt ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+ +
  OGLUM06G00620.1 180 RMRWTTTLHARFVHAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQNTK 231
                      89***********************************************975 PP

Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    
MMELFPRQLD LSLHISTPSC FSPSPASAST TASSWPWTTK QQLPEEEEAA ATTSTTTSSR  60
SAPPLLLCNS DVFSTRGSST TNTNHHADGG LANSQQLKAA ARQPIHGIPV YHGHQQQQRR  120
QLHHPYDVVG TRQSDGGRRL FSHHVGVGVT PSRTLSSSSS SPVRLLPRLP PGRRSVRAPR  180
MRWTTTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQNT KLSVDLETSM  240
LRLPGRPNLE FTLGIGKASQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-28G2-like family protein