PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G22140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 411aa    MW: 45988.3 Da    PI: 7.2705
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G22140.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29.1e-344498155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprl+WtpeLH+rFv+av+qLGG+ekAtPkt+++lm+++gLtl+h+kSHLQkYRl
  OGLUM05G22140.1 44 KPRLKWTPELHQRFVDAVNQLGGAEKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 98
                     79****************************************************8 PP

2Myb_DNA-binding68.41.2e-214697148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r++WT+e+++++vdav+qlGg    t+kt++r mg  g+tl+++ks++qky+
  OGLUM05G22140.1 46 RLKWTPELHQRFVDAVNQLGGAekaTPKTVMRLMGiPGLTLYHLKSHLQKYR 97
                     89******************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    
MYHQHQGRSD LFTTRTSFPM ERHLFLHGGN TQGDSGLVLS TDAKPRLKWT PELHQRFVDA  60
VNQLGGAEKA TPKTVMRLMG IPGLTLYHLK SHLQKYRLSK NLQGQANVGT TKNALGCTGV  120
ADRIPGTSAL AMASASAIPQ AEKTIQIGEA LQMQIEVQRQ LNEQLEVQRH LQLRIEAQGK  180
YLQAVLEQAQ ETLGKQNLGP ASLEDAKIKI SELVSQVSNE CLSNAVTEIR ESSSIHRLEP  240
RQIQFVESSA NNCLTAAEGF KEHRLQNHGV LKAYDDSTLF CRKQSQDQES QYSLNRSLSE  300
RRMGHLYSGK QYHKSEGSDS DTEVLHEYIT PQKNGGGSTT SSTSGSKEIN VEKLYLDEPS  360
CKRQTVDYQR ESKLLDFDQQ SSGKSLDLNT HNIDDKDQGY RHFDLNGFSW S
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.11e-101G2-like family protein