PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G28560.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 424aa    MW: 46308.2 Da    PI: 7.0698
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G28560.2genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.91e-32241295155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  OGLUM04G28560.2 241 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 295
                      68****************************************************7 PP

2Myb_DNA-binding54.82.1e-17245294348
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      rWT++++e++vd+v+qlGg    t+k I + m+  g+t +++ks++qky+
  OGLUM04G28560.2 245 RWTQDLHERFVDCVNQLGGAdkaTPKGILKLMNsDGLTIYHIKSHLQKYR 294
                      9*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    
MLQDIMNTKK IKLHDCHFGS PLCDPSPAPH LLSSAAAAGL SFHPGLVSSA AQHQQHGAGG  60
WLHEEYYAPR SSPPSSLLAQ TCVGSNATAF YAAENLPQFD FPALGTAAAA AAKAPFRSSE  120
SELYRPVDPL LLRADHSVRT YYVRPQKRDS GERTPLPPPS QQQHQDRIHG LFAGAPTTRL  180
LSGEPKIHSF PPQVAAKPIL PAMDAPSLQN QMENQLTRNC IGAATPVTPT GNLAGSGAPS  240
KTRIRWTQDL HERFVDCVNQ LGGADKATPK GILKLMNSDG LTIYHIKSHL QKYRIAKYMP  300
ASSEGKQLEK RATGNDMQNL DPKTGMQITE ALRVQLDVQR RLHEQLEIQR NLQLRIEEQG  360
KRLQKMFEDQ LKASRSVMEP QELDDVVAFA AGDGDDDAFD DVDVQLLAVA GSGYDDAGFQ  420
SKIS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.16e-67G2-like family protein