PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G28560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 438aa    MW: 47707.1 Da    PI: 6.9207
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G28560.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32255309155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  OGLUM04G28560.1 255 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 309
                      68****************************************************7 PP

2Myb_DNA-binding54.82.2e-17259308348
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      rWT++++e++vd+v+qlGg    t+k I + m+  g+t +++ks++qky+
  OGLUM04G28560.1 259 RWTQDLHERFVDCVNQLGGAdkaTPKGILKLMNsDGLTIYHIKSHLQKYR 308
                      9*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    
MVVVVVVVVG CFAILEIDIM NTKKIKLHDC HFGSPLCDPS PAPHLLSSAA AAGLSFHPGL  60
VSSAAQHQQH GAGGWLHEEY YAPRSSPPSS LLAQTCVGSN ATAFYAAENL PQFDFPALGT  120
AAAAAAKAPF RSSESELYRP VDPLLLRADH SVRTYYVRPQ KRDSGERTPL PPPSQQQHQD  180
RIHGLFAGAP TTRLLSGEPK IHSFPPQVAA KPILPAMDAP SLQNQMENQL TRNCIGAATP  240
VTPTGNLAGS GAPSKTRIRW TQDLHERFVD CVNQLGGADK ATPKGILKLM NSDGLTIYHI  300
KSHLQKYRIA KYMPASSEGK QLEKRATGND MQNLDPKTGM QITEALRVQL DVQRRLHEQL  360
EIQRNLQLRI EEQGKRLQKM FEDQLKASRS VMEPQELDDV VAFAAGDGDD DAFDDVDVQL  420
LAVAGSGYDD AGFQSKIS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.19e-67G2-like family protein