PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G23960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 251aa    MW: 27974.9 Da    PI: 9.2938
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G23960.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.9e-342377155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWtp+LHerFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  OGLUM04G23960.1 23 KPRLRWTPDLHERFVDAVTRLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 77
                     79****************************************************8 PP

2Myb_DNA-binding69.74.9e-222576148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT++++e++vdav++lGg+   t+k++ r mg kg+tl+++ks++qky+
  OGLUM04G23960.1 25 RLRWTPDLHERFVDAVTRLGGPdkaTPKSVLRLMGmKGLTLYHLKSHLQKYR 76
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    
MFEGCYGGVG SAAAAAAATR DPKPRLRWTP DLHERFVDAV TRLGGPDKAT PKSVLRLMGM  60
KGLTLYHLKS HLQKYRLGRQ SKKSAGLELA VADSGDALKY QVEVQRKLQE QLEVQKKLQM  120
RIEAQGRYLK EILEKAQKNI SLDANGSANL SSTRSQITDI NLALSGFMDN ATQVQEENNE  180
LMKPISDDNL KVNNLGFQLY HLGSQESKDV KCTPKTEELL LLDLNIQGGY ELSSRGMQGC  240
ELDLKINQQR R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-47G2-like family protein