PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G35130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 392aa    MW: 40241.3 Da    PI: 6.9227
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G35130.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32121174255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OGLUM03G35130.1 121 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 174
                      9****************************************************7 PP

2Myb_DNA-binding49.97.2e-16122173148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWTt ++ ++v+av++lGg+   t+k++ + m+ k +tl ++ks++q+y+
  OGLUM03G35130.1 122 RMRWTTALHARFVHAVELLGGHeraTPKSVLELMNvKDLTLAHVKSHLQMYR 173
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    
MLQRNLPNLS LRISPPAVSS AAAPVSSGTP TTAARTTLPT GVITDAEGGG EVAAFFGNPS  60
SGSEPPGLSL GLGPTTPAHA DAGGGRHGDH HLQPQGCAPF KRAAARASQL PAGSKRSVRA  120
PRMRWTTALH ARFVHAVELL GGHERATPKS VLELMNVKDL TLAHVKSHLQ MYRTVKSTDR  180
SSHIASGEAQ LQQQAGMEVA MEAAAGGGGN GGGGGGGVVL PMMPACDDMV GICSSPAPPA  240
AATSSAAAYF LCATTTSTAT APLAVVPSPP APTIPTRRTD QTPVLEKGVA IVDSLHRCQK  300
HNYSPVLQDA LHQGAEEDHL ITGNLPMGGA SAQASIEAMA TTNSSSPASS SPSLASLEQL  360
LPEDSFAPNL EISLGRQNWN MDHPEELSLK YL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-39G2-like family protein