PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G34980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 348aa    MW: 37315.9 Da    PI: 7.506
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G34980.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32224279156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k r++W+peLH++Fv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  OGLUM03G34980.1 224 KSRRCWSPELHRQFVAALQQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 279
                      68****************************************************97 PP

2Myb_DNA-binding44.24.3e-14226277148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W++e++ ++v a +qlGg+   t+k I + m   g+t  ++ks++qky+
  OGLUM03G34980.1 226 RRCWSPELHRQFVAALQQLGGPqvaTPKQIREVMKvDGLTNDEVKSHLQKYR 277
                      568************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    
MGLDVGEIGM GLDLSLDLKM FAARSAVRMA AAAAKEATGV EACIRSLEEE RRKIEMFRRE  60
LPLCARLLAD VIELMKEEAG KRRKDGDDAE AKAEDGDKTK WMSTAQLWVD SRGSDADSEN  120
DRRSGSTSPA SRLLGGAEES SSRAVSPPPY FRREERVVLR PAMPLLPPAS HRSPPPAAAA  180
AATAAGDDHR HVVASSFATA VPSPVPAALS LQAQAQQQQQ QARKSRRCWS PELHRQFVAA  240
LQQLGGPQVA TPKQIREVMK VDGLTNDEVK SHLQKYRLHN RKSPGTASAS HSIVLVGDLW  300
ASQEVSCSQS GSPQGPLQLS GSGVAVSAAT AGDSCCEDDD KSEGYVRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-40G2-like family protein