PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G27310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 443aa    MW: 46664.1 Da    PI: 9.8204
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G27310.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.72.2e-22116160246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OGLUM03G27310.1 116 PRMRWTTALHAHFVQAVELLGGHERATPKSVLELMNVKDLTLAHM 160
                      9*****************************************996 PP

2Myb_DNA-binding30.21e-09117159139
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkq 39 
                      r+rWTt ++  +v+av++lGg+   t+k++ + m+ k +tl +
  OGLUM03G27310.1 117 RMRWTTALHAHFVQAVELLGGHeraTPKSVLELMNvKDLTLAH 159
                      89**********************************9999876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    
MATTAATAPD LSLHISPPSP PDMAAGGETM EQLAEPKLCL GFGTAAAAAA AEQYNNGGCN  60
LQQQQWLHQP SQIQRFKKSA SGGSPVCSGG ATGTGGVAAA RSGNGGGGGK RSSRAPRMRW  120
TTALHAHFVQ AVELLGGHER ATPKSVLELM NVKDLTLAHM YRTVKGTTDR TCAEGHGQMR  180
DMGFLRRGGG GVDGFDVLGN TSSIAIANIR RQAAGSPGEH HQETMMSSAW CQPQFAQQQT  240
TACGLPLPCP YIVSTHHYLI KQNQLGGWRG SSGQQLAVQQ DAAAHSSLGI KNMGQQRLPA  300
AAAGSHDDEI VVASRIGRRS SGPAGFARSS PPAASGCWTP TTTTWSPPPP LTPQTTSTTT  360
TTRGSSVVVA AAAQACMKQQ QQQQTPSRVP SLEISLGRQG WQSGSSLEQQ QQHQQRHHQQ  420
QQRQRSVESS ASKELTLLNA FMA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.24e-25G2-like family protein