PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G15970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 355aa    MW: 39504.7 Da    PI: 7.4667
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G15970.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-3447101155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+WtpeLHerFveav+qLGG+ekAtPkti++lm+v+gLtl+h+kSHLQkYRl
  OGLUM03G15970.1  47 KPRLKWTPELHERFVEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRL 101
                      79****************************************************8 PP

2Myb_DNA-binding73.43.4e-2349100148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r++WT+e++e++v+av+qlGg+   t+ktI+r mg  g+tl+++ks++qky+
  OGLUM03G15970.1  49 RLKWTPELHERFVEAVNQLGGPekaTPKTIMRLMGvPGLTLYHLKSHLQKYR 100
                      89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    
MYHHQQQLQS HNQLLPSRQS FPSERHLLMQ GGSVSGESGL VLSTDAKPRL KWTPELHERF  60
VEAVNQLGGP EKATPKTIMR LMGVPGLTLY HLKSHLQKYR LSKNLHAQAN AGNVKNALVC  120
TTATEKPSEA NGSPVSHLNL GTQTNKSVHI GEALQMQIEV QRRLHEQLEV QRHLQLRIEA  180
QGKYLQSVLE KAQETLAKQN AGSVGLETAK MELSELVSKV STECLQHAFS GFEEIESSQM  240
LQGHTMHLGD GSVDSCLTAC DGSQKDQDIL SISLSAQKGK EIGCMSFDMH VKERGSEDLF  300
LDKLNRRPSN HPERCERRGG FSMSCQTANL DLNMNDTYDG PKHCKKFDLN GFSWA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.19e-96G2-like family protein