PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G02310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 404aa    MW: 42443.4 Da    PI: 8.0681
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G02310.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1018e-322174255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  OGLUM03G02310.1 21 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 74
                     8****************************************************5 PP

2Myb_DNA-binding51.42.4e-162273148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT++++  +v+a+++lGg    t+k++ + mg  g+t  ++ks++q+y+
  OGLUM03G02310.1 22 RLRWTPDLHHCFVHAIHKLGGQdkaTPKRVLQLMGvGGLTISHVKSHLQMYR 73
                     89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    
MVGGGRERNG GVRQYNRSKV PRLRWTPDLH HCFVHAIHKL GGQDKATPKR VLQLMGVGGL  60
TISHVKSHLQ MYRNMRNDLG MQGIQVQQVD QEHTYGGGVE VWTDMQQCDH DECDVPCCSC  120
HSPKPRKEPL LHLQLKSSGM NIDEPGTRAR IAAPNVRSCR DDAAASATET RRRRGGRPEE  180
VDDDANASAS PRISQLQLLH LRGHGIRESD MSPSTSLQCY YVRSQRTTTM PPGAAAAAAG  240
GDGGSQCYAA PRYSSSSKLK FLGFVVTSGP PPPPPPPPRL PPPAACCCGS DDNIPFQVGT  300
FAPHRVAPPT ASCGGGGGGR AEARPSSSYR SVWFEPAAAA AASNNGVAPD GEHDDGCSLS  360
LSLALDTGCG GAGAGAGGSL VTSTTSSSSG SRISLDLSLS TLDS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-26G2-like family protein