PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G38210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 742aa    MW: 82477.4 Da    PI: 5.1391
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G38210.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.44.9e-166126412655
          G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +AtPk++ ++mkv+gLt++hvkSHLQkYR+
  OGLUM02G38210.1 612 EATPKAVQKVMKVDGLTIYHVKSHLQKYRT 641
                      7****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    
MEELLGLVRG FVDVLVLAGG RTSSGAAATW RSGDVKKALQ WALFFEEVFK NLRDDGQYDE  60
SASELDAALV QLASSPNFPK GIEDIRAKTL AMARELVVKH FLKTTNAENL GAVLQAVVEM  120
DMDGISASGE CNVCQEYVQS ILDMNLPSLM RTKNARDVGH STSSDEFCEE SLFTGNSQIL  180
LKELQKKLDS GSCISLAERE LNTLLKSMKK DSFDSAGSTL CTSATAQKTQ IIDKFILWKQ  240
WKAKCLSYLL DERTIRIMSG TNMIFNAPKE QWMGLFEPLK VSADSSQSGI IEVMELCLLG  300
LVARQWNSLI ESIMSHTFSS FPISKQYADL HQLLQGTTQD ECQDKLLGFK EMDICEYARQ  360
SLESEPYILW LLPPVLTAAA MPPRSSLFKI YLVEIDKQLG EAASKDRTVR FLKGFNVSTH  420
SMFKELNCQF SSGSSHGPQF KTVQEICTSN FTSDLYINNS ESPNGKLSSE SYAIDTSGCD  480
SSLPPTQSLY KGNPSSLRMV YPKVSEQNSW SQEPLPGPFV CPTSVDFFDQ QDMTIFDQQI  540
QDNIAASPST NLAKQNEWFS SGTSLQYLES SVSAGSVLKA VDATSTTPSN YLHCHAQRNT  600
SNPPNFNEIC SEATPKAVQK VMKVDGLTIY HVKSHLQKYR TVHHRPQLSD GRGMETTCEG  660
LKVQIGLQKQ LHEQLEIQRK LQLQVEEHSK YLAMIIEKQS ESLRQLGALP RSLDAPTQVL  720
DNRETCEGQT GDADSAEQKP EK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-27G2-like family protein