PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G29460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 376aa    MW: 40135.7 Da    PI: 7.7184
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G29460.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32196249255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OGLUM02G29460.1 196 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 249
                      9****************************************************7 PP

2Myb_DNA-binding48.91.5e-15197248148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWTt ++ ++v+av++lGg+   t+k++ + m  k +tl ++ks++q+y+
  OGLUM02G29460.1 197 RMRWTTSLHARFVHAVELLGGHeraTPKSVLELMDvKDLTLAHVKSHLQMYR 248
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    
MELFPAHPDL QLQISPPPAT KSMDLGFWKR ALETSTTTTT AAAAASTGPS VATSSSPPVA  60
SGGVGGGAGG FYQQAAVAPA ANGHGHGHGH HHHHHQHHQL GGALQFLHRT QPIPPQDAAA  120
GGGLQDLAFA RPIRGIPVYN TSRPLPFLQS HHLQHHQHCY ADAIGVAPGA GPRSPSKQAA  180
ALRLAAAPAK RGARAPRMRW TTSLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV  240
KSHLQMYRTI KTTDHKQPAP PYGQTKTIIE IPDDNLFDIN NTSGSESSVQ QQSNLDGNEQ  300
GSSMCALRSN NSSSRGAWFH DKSRDATPGD IKSFEDVQSQ SPEDDDASDL NSPPFQIPET  360
TVSAMKPNLD FTLGRM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.14e-32G2-like family protein