PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G28020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 306aa    MW: 34083 Da    PI: 10.6077
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G28020.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.78.1e-312072254
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                     prlrWt eLH++Fv+a++ LGG++kAtPk il+lm+v gLt++hvkSHLQ+YR
  OGLUM02G28020.1 20 PRLRWTAELHRSFVRAIDCLGGQQKATPKLILQLMDVRGLTISHVKSHLQMYR 72
                     8**************************************************** PP

2Myb_DNA-binding42.12e-132172148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT+e++  +v+a+  lGg    t+k+I + m   g+t  ++ks++q+y+
  OGLUM02G28020.1 21 RLRWTAELHRSFVRAIDCLGGQqkaTPKLILQLMDvRGLTISHVKSHLQMYR 72
                     89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    
MGISGERKGA ARQYNRSKVP RLRWTAELHR SFVRAIDCLG GQQKATPKLI LQLMDVRGLT  60
ISHVKSHLQM YRGTRHGIGQ NDMQPQLHLK QHSFGSDEQS PKEFMCPPIK RAKVGTEASG  120
KYRCMEGSSD MRSSAPPAGT RYFIDDCMRL QEVSMDRRRS DQHDAAAAAR ARAPAAAASS  180
LHQALGFWVQ GRREEPFMVH QISKPKAHQL NHMVRNMKIS CKENHESRFF MVRSATRDEQ  240
VKKRAPPLSL AVDQKAANAI SSWPSEASCV ISPSPRNFST DCSGPPGCSF VGRRVNLELS  300
LSICGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-31G2-like family protein