PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G14610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 412aa    MW: 44579.2 Da    PI: 6.6338
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G14610.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32235290156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      kpr++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OGLUM02G14610.1 235 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                      79****************************************************97 PP

2Myb_DNA-binding39.61.2e-12237288148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W +e++ ++++a +qlGg    t+k I + m   g+t  ++ks++qky+
  OGLUM02G14610.1 237 RRCWAPELHRRFLQALQQLGGShvaTPKQIRELMKvDGLTNDEVKSHLQKYR 288
                      568*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    
MEVDHADRDG ARRRCREYLL ALEEERRKIQ VFQRELPLCF DLVTQTIEGM RSQMDAAGSE  60
ETVSDQGPPP VLEEFIPLKP SLSLSSSEEE STHADAAKSG KKEEAETSER HSSPPPPPPE  120
AKKVTPDWLQ SVQLWSQEEP QQPSSPSPTP TKDLPCKPVA LNARKAGGAF QPFEKEKRAE  180
LPASSTTAAA SSTVVGDSGD KPTDDDTEKH METDKDNDKD AKDKDKEGQS QPHRKPRRCW  240
APELHRRFLQ ALQQLGGSHV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSSTGQS  300
SAAAGVPAPP APQFVVVGSI WVPPPEYAAA AAAQQHVQLA AAGNNASGSA NPVYAPVAML  360
PAGLQPHSHR KQHQQQQQGQ RHSGSEGRRS GDAGDGSSSS PAVSSSSQTT SA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-57G2-like family protein