PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G05510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 385aa    MW: 40477.7 Da    PI: 7.697
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G05510.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-3346100155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  OGLUM02G05510.1  46 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 100
                      79****************************************************8 PP

2Myb_DNA-binding72.46.9e-234899148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT e++e++vdav+qlGg+   t+ktI+r mg kg+tl+++ks++qk++
  OGLUM02G05510.1 48 RLRWTVELHERFVDAVTQLGGPdkaTPKTIMRVMGvKGLTLYHLKSHLQKFR 99
                     89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    
MFPGSKKGGG GGAAVSSGDG GGGRAAAAAA MCVQGDSGLV LTTDPKPRLR WTVELHERFV  60
DAVTQLGGPD KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFSE HSVKEAAAME  120
MQRNATSSSG IMGRSMNHDR NVNDAIRMQM EVQRRLHEQL EVQKHLQMRI EAQGKYMQSI  180
LEKAYQTLAA GDVAAAVACG PAGYKSLGNH QAAVLDVCSM GFPSLQDLHM YGGAGGGHLD  240
LQQQQPPAST MESFFACGDG GGSLGKTAAK TRHYGGAGKS PMMWGVDDDD DDDDPAGKCG  300
GGGHHQLQMA PPPMMDGGID VMDSLAADVY EPKPIMSGDS TGSKGGGYDV ATAASKLERP  360
SPRRPPQLGS PSVMAGAQTR NLSYG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-94G2-like family protein