PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G05030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 235aa    MW: 25756.7 Da    PI: 9.4843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G05030.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like902.1e-283386255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     pr+rW +eLH+rF +av++LGG ++AtPk+i++lm+ kg++++hvkSHLQ+YR 
  OGLUM02G05030.1 33 PRMRWPEELHRRFAHAVRRLGGCHEATPKRIMQLMGAKGVSISHVKSHLQMYRN 86
                     9****************************************************6 PP

2Myb_DNA-binding47.83.2e-153485148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rW +e++ ++++av++lGg    t+k+I++ mg kg +  ++ks++q+y+
  OGLUM02G05030.1 34 RMRWPEELHRRFAHAVRRLGGCheaTPKRIMQLMGaKGVSISHVKSHLQMYR 85
                     89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    
MGARGRRDRM GSAGGGGGSP PVVVRRYNRS EAPRMRWPEE LHRRFAHAVR RLGGCHEATP  60
KRIMQLMGAK GVSISHVKSH LQMYRNSNNS SNVNRRHPVT PQIDWTTTAQ QDEQQRRQMS  120
SFSFLATRTV PAAGIGSHSH QRPHRRQALH AGDDDGCELT LSISGGAAEE SKDGGSSITD  180
DDDELLIQPP APNIINDDGS TRHGHRHPFA CSTQPPPPAA INLELTISSP CCWLT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-20G2-like family protein