PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G03100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 465aa    MW: 51569.5 Da    PI: 5.6572
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G03100.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-33263317155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprlrWtpeLHerFv+av++L G+ekAtPk +l+lmkv+gLt++h+kSHLQkYRl
  OGLUM02G03100.1 263 KPRLRWTPELHERFVDAVNKLEGPEKATPKGVLKLMKVEGLTIYHIKSHLQKYRL 317
                      79****************************************************8 PP

2Myb_DNA-binding57.82.5e-18265316148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT+e++e++vdav++l g+   t+k + + m  +g+t +++ks++qky+
  OGLUM02G03100.1 265 RLRWTPELHERFVDAVNKLEGPekaTPKGVLKLMKvEGLTIYHIKSHLQKYR 316
                      89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    
MSTQSAIAVK QFSGPDKIAQ AYTVPQPSAH VLSNANYDLC GSTNSTSLSC AIQSSNIKTE  60
SISSSSLPKI LPFSTDSNGE SSLSRMSQAE FSDPILSSSS TFCTSLYTSS PMNSGSCRKT  120
GYLPFLPQPP KCEQQENSAG QSSSSLMLLD ADLRNSGHAD DEHTDDLKDF LNLSSDCSFH  180
GKCSAMAYNE QMEFQFLSEQ LGIAISNNEE SPRLDDIYDR PPQLMSLPVS SCSDQEDLQD  240
ARSPAKVQLS SSRSSSGTAS CNKPRLRWTP ELHERFVDAV NKLEGPEKAT PKGVLKLMKV  300
EGLTIYHIKS HLQKYRLAKY LPETKEDKKQ EEKKTKSVAN GNDHAKKKSA QMAEALRMQM  360
EVQKQLHEQL EVQRQLQLRI EEHARYLQKI LEEQQKARES ISSMTSTTEG ESPEFAPMEK  420
TEDKAETSSA PLSKCRITDT DAECHSKVDN KKTKPQADLE MVHDE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.13e-66G2-like family protein