PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G02260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 543aa    MW: 58803.9 Da    PI: 6.0214
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G02260.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31118171255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  OGLUM02G02260.1 118 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 171
                      8****************************************************7 PP

2Myb_DNA-binding47.93.1e-15119170148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rWT++++  +v+av++lGg    t+k++ ++m+  g++  ++ks++q+y+
  OGLUM02G02260.1 119 RLRWTPDLHMAFVHAVERLGGQeraTPKLVLQMMNvRGLSIAHVKSHLQMYR 170
                      89************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    
MKEKEVLVEI VEDDELKRSI GRNQLDLNEE VMDVESEEGE VGDDEDDEDE EDDDDDDDGG  60
STTDVAGSRS SSNNSSTNNV SESKLKGDKD SGGGRLEGIN GGEQRVPSVR QYNRSKLPRL  120
RWTPDLHMAF VHAVERLGGQ ERATPKLVLQ MMNVRGLSIA HVKSHLQMYR SKKLDHEGRQ  180
IRGAIASVFS PMDFHLMRGD LRFHDMLLQR AAALSSSRQE HGGFFSSRSG GGGGGLPPEA  240
SRLYGLLQHR QSPAMATMQT FDFKNSSFRN QEWSFSFNHQ RKETMNPSSS SSTTAAIRRW  300
PSAAGAVADV AGERQRLAER FGYYTGNGGA SSTSLPLITR AAMAAPPPMF AAAVAPPGRD  360
HHRLPFGWHA GGGGGGNKNR SSSDPVVIDE ALDSRRLEHQ QKHVEQPRTT LTTTTTPAGK  420
RPPEWSPPDL QLTLSPTTAP AAADGGGAKR SKTSTTTTNT TAAISGEQEA EKNMDRCKNK  480
LSISLSLSPP AAAAAAANFS SMDLSMEQQK QKQEKTTIGS SEEEAGDLGQ STLDLTMSIR  540
ALE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein