PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G49830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 238aa    MW: 25584.3 Da    PI: 7.0109
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G49830.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.39.5e-30119171255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      +rl+Wtp+LH+rFve+v++L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  OGLUM01G49830.1 119 ARLVWTPQLHKRFVEVVAHL-GMKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 171
                      79******************.9*******************************8 PP

2Myb_DNA-binding50.64.3e-16120170148
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+ WT+++++++v++v+ lG++   +ktI++ m+ +g+t++++ s++qky+
  OGLUM01G49830.1 120 RLVWTPQLHKRFVEVVAHLGMKnaVPKTIMQLMNvEGLTRENVASHLQKYR 170
                      789***********************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    
MGEEAPEEYE LGGGEDERVM EWEAGLPGAD ELTPLSQPLV PAGLAAAFRI PPEPGRTLLD  60
VHRASAATVS RLRRASSSSS SSFPAFASKG AGAGADEAES GGGADGGNGN TNNNSSKRAR  120
LVWTPQLHKR FVEVVAHLGM KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYVKRMQGLS  180
NEGPSPSDHI FASTPVPHAS LHDQVPSPYH PHPHHHSYNN AAYAATVSSY HHYHHANH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.32e-48G2-like family protein