PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G41000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 270aa    MW: 27889.2 Da    PI: 6.1606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G41000.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.43.8e-29142195155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r++WtpeLH+rFveav++L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  OGLUM01G41000.1 142 KARMVWTPELHHRFVEAVAHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 195
                      68*******************.9*******************************8 PP

2Myb_DNA-binding476.1e-15144194148
                      TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+ WT+e++ ++v+av+ lG +   +k+I r m+  g+t++++ s++qky+
  OGLUM01G41000.1 144 RMVWTPELHHRFVEAVAHLGEKgaVPKAIVRLMNvDGLTRENVASHLQKYR 194
                      789***********************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    
MLSARGGRPH DADAPLPSSS SSSSSSSSSS SSPSRRMVDA AAASGDACGR VTEWETGLPA  60
PGEMTPVSHQ LVPPALAAAF GIDLAAVGVL LPSPSVDSPV SHLFFPVDED DDEDEEGEGE  120
GGNDDAPAAA AAGGGGGRCG KKARMVWTPE LHHRFVEAVA HLGEKGAVPK AIVRLMNVDG  180
LTRENVASHL QKYRLYLKRT RVAATPPPSP PPPPPPPPPL PPAMYVPCFA AKPPLDAANR  240
SDSPPSRTSD ATTKQNQVKP IKERAVSNAA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.19e-29G2-like family protein