PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G05410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 509aa    MW: 53266 Da    PI: 5.9487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G05410.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-31268323156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OGLUM01G05410.1 268 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 323
                      68****************************************************97 PP

2Myb_DNA-binding414.3e-13270321148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r  W++e++ ++v+a + lGg    t+k I + m   g+t  ++ks++qky+
  OGLUM01G05410.1 270 RRCWSPELHRRFVNALQILGGAqvaTPKQIRELMKvDGLTNDEVKSHLQKYR 321
                      568*****************99*****************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    
MASSSSDLTL DDHHHLTAVA AASGQATQKL QEFLSRLEEE RLKIDAFKRE LPLCMQLLNH  60
AMEAYRQQLE AYQMGSQHGA AAAAAARAPL VLEEFIPVKN IGIDVVAADK AAAAAAGGNS  120
VSSEKASWMV SAQLWNAPAS ASAADTAAKG PQTPKEHSEH HPLDTSPKLI TALDGGGGGG  180
AFLPFSKDNA MGDGSAAAAA AALPELALAP AEKAADAITI AAGEVDKKPY AHDNGVVARS  240
REAQNGGKPP STPPDGQAVP PPPQPHRKAR RCWSPELHRR FVNALQILGG AQVATPKQIR  300
ELMKVDGLTN DEVKSHLQKY RLHTRRPMPS PAPPTAATPQ LVVLGGIWVQ PEYATQAAGP  360
AIYGAHPATQ PHYTAAVAAQ EYYHHHHHHL QHHPAAAALV HHRAVAPPPP LPPQQQLAPP  420
YSAKSSASAR LGSPDSDGRG SGGGAAAAAS GAGRDMSESI EEEGEGEERE DDDDYDEMAA  480
TNNAHAVDGD DDDDEINTTT TTSAGAINY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-39G2-like family protein