PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT39754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 185aa    MW: 20722.7 Da    PI: 5.8101
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT39754genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.2e-3912108197
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
               +C+aCk+lrr+C++dC++ p+fp+++p+kf +vh++FGasn+ k+l+++p ++reda+ s+vyeA ar+rdPvyG+vg+i++lq+++ +l++el+++
  OIT39754  12 PCSACKFLRRRCTQDCIFLPHFPSAEPQKFIAVHRIFGASNINKILQETPADNREDAVISMVYEATARLRDPVYGCVGIISALQKHVFHLQSELNEA 108
               7********************************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    
MSSTSKKNKH MPCSACKFLR RRCTQDCIFL PHFPSAEPQK FIAVHRIFGA SNINKILQET  60
PADNREDAVI SMVYEATARL RDPVYGCVGI ISALQKHVFH LQSELNEALA EVMSLQTQLS  120
DALSLPSLIE GSPITPENHE FLHFQKPSEQ NAYANASDAL LLLPEAADHY CLQETEVLQL  180
PYLDI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-46LBD family protein