PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT39563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 185aa    MW: 21386.8 Da    PI: 9.7201
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT39563genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32106164159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk+++fprsYYrCt++gC vkk+v+r ++d+ vv++tYeg H h+
  OIT39563 106 LDDGYRWRKYGQKAVKNNRFPRSYYRCTHQGCDVKKQVQRLSKDEGVVVTTYEGMHSHP 164
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    
MENYQHFFPN YSSSSSDQFS LMNMMNNNSH TKAAELTQDN RKSSGFLGLM ASMEAPSSSV  60
VTDHTNSIPY NSNDQNEVRS GKKNKGEKKI KKPRYAFQTR SQVDILDDGY RWRKYGQKAV  120
KNNRFPRSYY RCTHQGCDVK KQVQRLSKDE GVVVTTYEGM HSHPIEKSTD NFEHILTQMQ  180
IYASF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-60WRKY family protein