PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT39215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 172aa    MW: 18777.2 Da    PI: 7.8304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT39215genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.81.2e-45131121100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l+e++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+++la +++e
  OIT39215  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELSEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDHLQTQLAIAQAE 112
               7**********************************************************************************************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    
MKESGRKQSA ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LSEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID HLQTQLAIAQ AEVVHMRMRQ  120
FSSMSSGGGT AGNSPENVSP SSRHTQTQPT MSLFTMDMVV DQANMGESLW SC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-79LBD family protein