PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT39097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 235aa    MW: 26573.2 Da    PI: 7.8892
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT39097genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.3e-32161219159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  OIT39097 161 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 219
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    
MERGEGRELN NYDLQVSFSA PHDLGFVHFA DHNQMMSFLA PPSSHSQLSS QIPQPLQAAA  60
ATTVTPPTTT TNATAAAASN NISSALGFNH NEFVNRPSWN NDQVEILDPK VVNDENCTGN  120
ASEGNNSWWK SSSSDKGKVK IRRKLREPRF CFQTRSDIDV LDDGYKWRKY GQKVVKNSLH  180
PRSYYRCTHS NCRVKKRVER LSEDCRMVIT TYEGRHNHSP SDDSNSSEHD CFTSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140146KIRRKLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.13e-53WRKY family protein