PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT38439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 226aa    MW: 24951.9 Da    PI: 8.4063
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT38439genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.66.9e-46131121100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k+e
  OIT38439  13 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLSCAKSE 112
               7**********************************************************************************************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    
MSSSSSSLSS NSPCAACKFL RRKCQPECVF APYFPPDQPQ KFANVHKVFG ASNVTKLLNE  60
LQPHQREDAV NSLAYEADMR LRDPVYGCVG VISLLQHQLR QLQMDLSCAK SELSKYQNLG  120
GIAGTTTHGL LAAAAAAAAT TAHHHQQFNF MAGGGRDHHH LYHHHQFFPR DQSQQQQQQH  180
QHMIRAFEGH GNNNFDASSL LLGQLSQFQQ PRAAGGDGRR TPVDPS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.33e-67LBD family protein