PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT37684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 313aa    MW: 34712.9 Da    PI: 9.2095
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT37684genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054e-33153211159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDg++WrKYGqK vk+s+fprsYYrCt+a+C vkk+vers+ed+++v++tYeg H+h+
  OIT37684 153 LDDGFRWRKYGQKAVKNSPFPRSYYRCTTATCGVKKRVERSSEDTSIVVTTYEGIHTHP 211
               59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    
MLLIKSMADK ENKLKPDTSS IEISTFSDQI PASSYSLFDM PTEKGSSLSL MFSSYPITTS  60
SIFDLLQPPP PPPPALPSQI VNKTPSSEIV NTPNSSSSTE AAANDDQLQP TTQRVDDDDQ  120
HKNKKQLKPK KKKQKREREP RFAFMTKSEV DHLDDGFRWR KYGQKAVKNS PFPRSYYRCT  180
TATCGVKKRV ERSSEDTSIV VTTYEGIHTH PCPITPRSSI GILSETTAYG GSIGGGGGGS  240
SLFIPQFHYQ QPTYFQTPTL PINLISTSDS SLYSSQERRF SPSTSSSSSS LARDHGLLQD  300
MVPSQMRRDP KQE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.14e-49WRKY family protein