PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT37599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 532aa    MW: 57582.5 Da    PI: 7.0414
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT37599genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.2e-33239295259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  OIT37599 239 DDGYNWRKYGQKHVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQVTEIIYKGQHNHQ 295
               8****************************************.***************8 PP

2WRKY106.61.3e-33418476159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+ +dpk+v++tYeg+Hnh+
  OIT37599 418 LDDGYRWRKYGQKVVKGNPYPRSYYKCTSQGCNVRKHVERAPSDPKAVITTYEGKHNHD 476
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    
MAENEASSSA SLSRAPMRPT ITLPPRASVE NLFMGGPGGI SPGPMTLVSS FFSDPASEYP  60
SFSQLLAGAM ASPADFSGQR QGFPPPPETT VSISKGKESG SGDMDFGFKQ NRPSGLVITQ  120
SPMFTIPPGL SPAGLLGSPL LFSPGQGPFG MSHQQVLAQV TAQAAHPQSQ MHIQPDYPSS  180
SAAPAPSFSQ FQSLTSNATA NQQILPPASD PNVMKEASEV SLSDQRSEPV SSAVDKPADD  240
GYNWRKYGQK HVKGSEYPRS YYKCTHPNCP VKKKVERSLD GQVTEIIYKG QHNHQPPQSS  300
KRSKESGNPN GNYNLQGPSE LSSEGVAGTL NNSKDSMPSY SLRMKDQESS QATHDQVSGS  360
SEGEEVGDAE TIADGNDERE SKRRAIEVQT SEAASSASHR TVAEPRIIVQ TTSEVDLLDD  420
GYRWRKYGQK VVKGNPYPRS YYKCTSQGCN VRKHVERAPS DPKAVITTYE GKHNHDVPAA  480
RNSSHNTANN SVSQMRPHNP VVDKQDATRR TGFSNNEQQP IELLRFKEEQ VT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-136WRKY family protein