PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT37488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 514aa    MW: 56576.3 Da    PI: 7.2637
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT37488genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.61.7e-30228283359
               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               DgynWrKYGqK+vk se+prsYY+Ct+ +Cpvkkkve s  d++++eitY+g+Hnhe
  OIT37488 228 DGYNWRKYGQKMVKASECPRSYYKCTHLKCPVKKKVELSI-DGHITEITYKGHHNHE 283
               9***************************************.***************7 PP

2WRKY104.94.3e-33400458159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDg++WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver++ dpk+v++tYeg+Hnh+
  OIT37488 400 LDDGFKWRKYGQKVVKGNHHPRSYYRCTYPGCNVRKHVERASADPKAVITTYEGKHNHD 458
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    
MGEKFKASAA VSELTIPPRA PNFEAFFGGG NMPYFSPGPM TLVSSFFSES EYPSFSQLLA  60
GAMASPLAKS PTLFLENSSG EENCKEGNQK NLGYKQNRPM SLMVAQNSPL FMIPTGLSPS  120
GLLNSPGFLS PLQSPFGMSH QQALAHVTAQ AALSQSYLQT QAEYHFSSQG TSAQVLGNET  180
STEPTESSLQ PQLDAMPSDQ QNKKIELPLV SQSEDKPSFA SVDRPACDGY NWRKYGQKMV  240
KASECPRSYY KCTHLKCPVK KKVELSIDGH ITEITYKGHH NHELPQPSKR RRDSCTQDGS  300
DCSKAKPESE MLSGTEVNGL NGAFPARSGQ VSTEMASGLL LSNECDKIED TATAAEEGHD  360
DEPNVKRMKT AVEAPNLASS HKAISESKIV VQTRSEVDIL DDGFKWRKYG QKVVKGNHHP  420
RSYYRCTYPG CNVRKHVERA SADPKAVITT YEGKHNHDIP IARNRSHSTA QDSTRQMNEQ  480
DVATWRPSLH ENVAFHNTNK IPVCRQLKEE EIGA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-121WRKY family protein