PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT36961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 289aa    MW: 32346.9 Da    PI: 4.7636
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT36961genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.2e-31125181258
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
               dDgy+WrKYGqK++k+s++prsYY+Ct ++C +kk+vers ++p++++itYeg H h
  OIT36961 125 DDGYKWRKYGQKSIKNSPYPRSYYKCTNPRCGAKKQVERSGDEPDTFVITYEGLHLH 181
               8******************************************************99 PP

Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    
MAMEELEELK NSWTYQDELI KELLDNESPL FFTPQDSNST SCPSSTDDSV VTKSFNISAV  60
SSGPNMDDIE SGLSVTSYGI QSHDVSHARA FGLERGLNLM MSKQESTHET KYTLRIKTCG  120
NGMADDGYKW RKYGQKSIKN SPYPRSYYKC TNPRCGAKKQ VERSGDEPDT FVITYEGLHL  180
HFAYPFFTLD PTQFLEQPNK KPKLTISKAQ NEESENASEV DESPKCLNLS PVIDFEQKLG  240
FGEMGSQGLL EDMVPLMVRN PSMKPTSSYS SSCSYSSPPT SPSFSWSNN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-52WRKY family protein