PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT33317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 217aa    MW: 24811.3 Da    PI: 7.5876
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT33317genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32143201159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  OIT33317 143 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 201
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    
MEGGHQERIL HNNYDLQVST PHANIHEMGF LHHFEHHQNQ VMSFSTSPLD GATPPTATCT  60
LAAATNNGSS SLGFYHSELV NRSSWNNDQV EIVDPKAVID ENCSGNASEG NNSWWRSSGK  120
VKVRRKLREP RFCFQTKSDI DVLDDGYKWR KYGQKVVKNS LHPRSYYRCT HSNCRVKKRV  180
ERLSEDCRMV ITTYEGRHNH SPCDDSNSSE NDCFSSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128KVRRKLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.12e-67WRKY family protein