PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT33210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 236aa    MW: 27107.5 Da    PI: 8.9371
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT33210genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32157215159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDg++WrKYGqK vk+s +prsYYrCt+++C+vkk+++r ++d+++v++tYeg Hnh+
  OIT33210 157 LDDGFKWRKYGQKAVKNSSHPRSYYRCTHHTCNVKKQIQRLSKDTSIVVTTYEGIHNHP 215
               59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    
MHYTSTSINA GEEPPPPPPP IPPPPLLSTD LSPANFFMQP NTSMLNNHLP LPNNSQVGCD  60
NIDWAGLFSS STTSGIDTEY FVHRTAPVNN NNEPTTMPNM SITPRNIMME GEQQQQQQQQ  120
HQQQQHDGYC RDKGKFRKRK YVPPRIAFHT RSTEDILDDG FKWRKYGQKA VKNSSHPRSY  180
YRCTHHTCNV KKQIQRLSKD TSIVVTTYEG IHNHPCEKLM ETLSPILKQL QFFARF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-56WRKY family protein