PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT32607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 177aa    MW: 19567.3 Da    PI: 7.7698
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT32607genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.6e-4471061100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++e
  OIT32607   7 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARVRDPVYGCVGAISLLQNQVSQLQMQLAVAQAE 106
               7***********************************************************************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    
MGSGSSPCAS CKLLRRRCAK DCIFAPYFPP DDPHKFAIVH KVFGASNVSK MLQELPVQQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISLLQ NQVSQLQMQL AVAQAEILCI QMQQEPVPSL  120
PTTCLMEPHH VEKSSPFSTS NATNYNFNNN LQSYLSFTSS STSHVMQDPV KRESLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-78LBD family protein