PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT32286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 133aa    MW: 14618.7 Da    PI: 8.1044
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT32286genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.5e-4211109199
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
               +CaaCk+lrrkC ++C++apyfp e+p kf  vhk+FGasnv+kll++++ ++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  OIT32286  11 PCAACKFLRRKCLPSCIFAPYFPPEEPIKFTTVHKVFGASNVSKLLNEIQSHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQKQVIRLQKELDATNA 109
               7*********************************************************************************************99876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    
ISSSSSYSNP PCAACKFLRR KCLPSCIFAP YFPPEEPIKF TTVHKVFGAS NVSKLLNEIQ  60
SHQREDAVNS LAYEAEARLK DPVYGCVGAI SVLQKQVIRL QKELDATNAD LMRYTSYESG  120
GGTGTLICQT YGM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.18e-65LBD family protein