PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT31275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 198aa    MW: 21925 Da    PI: 7.7507
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT31275genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.9e-42361351100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q+++l+a+la++++e
  OIT31275  36 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGSAGAIFQLQKQVNELQAQLAKAQAE 135
               7***********************************************************************************************9976 PP

Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    
MESSNRTVTT TKTPLSPCSV SPSRSSPSPP RVVVTPCAAC KILRRRCAEK CVLAPYFPPN  60
DPIKFTTAHR VFGASNIIKF LQELPESQRA DAVSSMVYEA NARLRDPVYG SAGAIFQLQK  120
QVNELQAQLA KAQAEVVNMQ CQQANLMALL YMEMDQSTPV SPEQSLDKLT STTFQSSMSF  180
LDDQNNNFGS LWDQPLWT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-66LBD family protein