PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT30000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 190aa    MW: 21020.4 Da    PI: 8.8539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT30000genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.45.9e-44511501100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasn++k+l+++p ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la +++ 
  OIT30000  51 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNISKMLQEVPVNKRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSHLQMQLAIAQAD 150
               7**********************************************************************************************99875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    
MKGLQNVVGK ESHGRCFKIK EPLQKVVVLL QYCVGEILNG NTSNIEPGNS PCASCKLLRR  60
RCAKDCIFAP YFPSDDPHKF AIVHKVFGAS NISKMLQEVP VNKRADAVSS LVYEANARMR  120
DPVYGCVGAI SYLQNQVSHL QMQLAIAQAD ILSSTNVISN SMNKIMYYSL KIRFINFSGE  180
DGDLVSQPSM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-69LBD family protein